SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG91_complete:A_TrvaMG_comp11250_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_rhomboid-related_protein_2-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000281 P mitotic cytokinesis
GO:0001763 P morphogenesis of a branching structure
GO:0004252 F serine-type endopeptidase activity
GO:0005743 C mitochondrial inner membrane
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006508 P proteolysis
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007409 P axonogenesis
GO:0007420 P brain development
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007431 P salivary gland development
GO:0007432 P salivary gland boundary specification
GO:0007436 P larval salivary gland morphogenesis
GO:0007438 P oenocyte development
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007611 P learning or memory
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0008355 P olfactory learning
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016337 P cell-cell adhesion
GO:0016787 F hydrolase activity
GO:0030707 P ovarian follicle cell development
GO:0035160 P maintenance of epithelial integrity, open tracheal system
GO:0035202 P tracheal pit formation in open tracheal system
GO:0035225 P determination of genital disc primordium
GO:0035311 P wing cell fate specification
GO:0038005 P epidermal growth factor receptor ligand maturation
GO:0042058 P regulation of epidermal growth factor receptor signaling pathway
GO:0045177 C apical part of cell
GO:0045742 P positive regulation of epidermal growth factor receptor signaling pathway
GO:0046845 P branched duct epithelial cell fate determination, open tracheal system
GO:0048149 P behavioral response to ethanol
GO:0048865 P stem cell fate commitment
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
RNA-seq EntryA_TrvaMG_comp11250_c0_seq1
Sequence
(Amino Acid)
MAGDSTDCESDQKTASAGWKVIPETTVSARAWVENEEPGENKQLLSPVKKPSQNAIVAIH
GYKGKKPKVREVQKPNLQQKLGKLALLLKPPYFIVIMIFITVCIHFLVSEDFKLKVVWIP
ENWWTKPWTLVTYGFIHANASHLAINALMALVVGWCLEREQGWWRMAVLWCGGVVSGALG
CGALQQHVRVVGSSAAVYTFLTAHLANVAYRYGHISLWWFRPLSVLVLGVSEGFWELFQM
KNTAWAAHALGAAAGIPIGFIIFTGENKAHHYVVIARIVSGMVLLLGVMMAVIHYTHLTE
RHHR
*(100 a.a.)

- SilkBase 1999-2023 -