SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG90_5prime_partial:A_TrvaMG_comp11249_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
hypothetical_protein_KGM_21654_[Danaus_plexippus]
Ontology
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007141 P male meiosis I
GO:0007165 P signal transduction
GO:0007283 P spermatogenesis
GO:0007286 P spermatid development
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0016568 P chromatin organization
GO:0016580 C Sin3 complex
GO:0016602 C CCAAT-binding factor complex
GO:0030317 P flagellated sperm motility
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032403 F protein-containing complex binding
GO:0035064 F methylated histone binding
GO:0035091 F phosphatidylinositol binding
GO:0040008 P regulation of growth
GO:0043065 P positive regulation of apoptotic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048133 P male germ-line stem cell asymmetric division
GO:0072520 P seminiferous tubule development
GO:1902166 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:2000772 P regulation of cellular senescence
GO:2001020 P regulation of response to DNA damage stimulus
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_TrvaMG_comp11249_c1_seq1
Sequence
(Amino Acid)
KVRQTTQRSETPPEEPDAIDPDEPRYCLCDQISFGEMILCDNDLCPIEWFHFSCVSLTTK
PKGKWFCPKCRGDRPNVMKPKGQFLKELERYNREKEEKA
*(32 a.a.)

- SilkBase 1999-2023 -