| Name | O_TrvaMG522_internal:A_TrvaMG_comp11990_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_zinc_finger_protein_583-like_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0000122 |
P |
negative regulation of transcription by RNA polymerase II |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003677 |
F |
DNA binding |
| GO:0003714 |
F |
transcription corepressor activity |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0030331 |
F |
estrogen receptor binding |
| GO:0033147 |
P |
negative regulation of intracellular estrogen receptor signaling pathway |
| GO:0043627 |
P |
response to estrogen |
| GO:0046872 |
F |
metal ion binding |
|
| RNA-seq Entry | A_TrvaMG_comp11990_c0_seq1 |
Sequence
(Amino Acid) | TNKKLPKVKQFKCSPCDVIFSSKEKLLIHRRERQCMKRACDVCGQLVLSIPHHMRQVHKQ
TVPHKCPTCNKEFTLLARLKNHMMIHTNTFNFFCDLCPYKC
(32 a.a.) |
