SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG364_5prime_partial:A_TrvaMG_comp11722_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_G_protein-coupled_receptor_kinase_2_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002805 P regulation of antimicrobial peptide biosynthetic process
GO:0003384 P apical constriction involved in gastrulation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004703 F G protein-coupled receptor kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007474 P imaginal disc-derived wing vein specification
GO:0008589 P regulation of smoothened signaling pathway
GO:0008592 P regulation of Toll signaling pathway
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030154 P cell differentiation
GO:0043950 P positive regulation of cAMP-mediated signaling
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0048477 P oogenesis
GO:0048601 P oocyte morphogenesis
GO:0050830 P defense response to Gram-positive bacterium
RNA-seq EntryA_TrvaMG_comp11722_c0_seq1
Sequence
(Amino Acid)
AGRRGAALVKAHRFFHNLNWARLEAGMVPAPFVPDPHAVYAKDVLDIEQFSTVKGVNLDA
ADDTFYGKFNTGSVSIPWQTEMIETGCYKELNVFGAAEDGKEAATVDLQLVPCAAAAEEE
QGCFVFARRVLCPQKKVPPRLRPVTVPDHLLPPASPLHS
*(52 a.a.)

- SilkBase 1999-2023 -