SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG360_5prime_partial:A_TrvaMG_comp11711_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		unknown_protein,_partial_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000724 P double-strand break repair via homologous recombination
GO:0000993 F RNA polymerase II complex binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008026 F helicase activity
GO:0009378 F four-way junction helicase activity
GO:0016591 C RNA polymerase II, holoenzyme
GO:0016787 F hydrolase activity
GO:0032508 P DNA duplex unwinding
GO:0034244 P negative regulation of transcription elongation from RNA polymerase II promoter
GO:0043140 F 3'-5' DNA helicase activity
GO:0051301 P cell division
GO:0051304 P chromosome separation
RNA-seq EntryA_TrvaMG_comp11711_c0_seq1
Sequence
(Amino Acid)
KDKEKELQKEKWKHKKKTNETSINKAEKVDVASLVVKLLMPYYKKKRISSRDLFKVTARH
IVHQLLAIQVTEEAAIAMILKKTFTKEMKIEKESDLTAKLNLKKDA
*(34 a.a.)

- SilkBase 1999-2023 -