SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG27864_internal:A_TrvaMG_comp1001644_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_rho_GTPase-activating_protein_7_[Bombyx_mori]
Ontology
GO:0001843 P neural tube closure
GO:0003007 P heart morphogenesis
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005901 C caveola
GO:0005925 C focal adhesion
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007165 P signal transduction
GO:0008285 P negative regulation of cell population proliferation
GO:0008289 F lipid binding
GO:0008360 P regulation of cell shape
GO:0016020 C membrane
GO:0021575 P hindbrain morphogenesis
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030336 P negative regulation of cell migration
GO:0030864 C cortical actin cytoskeleton
GO:0030900 P forebrain development
GO:0032587 C ruffle membrane
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035023 P regulation of Rho protein signal transduction
GO:0035024 P negative regulation of Rho protein signal transduction
GO:0035307 P positive regulation of protein dephosphorylation
GO:0042169 F SH2 domain binding
GO:0043547 P positive regulation of GTPase activity
GO:0048041 P focal adhesion assembly
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051497 P negative regulation of stress fiber assembly
GO:0051895 P negative regulation of focal adhesion assembly
GO:1900119 P positive regulation of execution phase of apoptosis
RNA-seq EntryA_TrvaMG_comp1001644_c0_seq1
Sequence
(Amino Acid)
AIFQRVPEPLRPDAVQCALLLLPEEHLEALHSLLIFLSDVAEHSAVNQMTASNLAVCLAP
TLLRLHHAPPTTGSTKEGNSNRMVIESVADQRQISESRAAHAC
(33 a.a.)

- SilkBase 1999-2023 -