SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG226_3prime_partial:A_TrvaMG_comp11507_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_AT-rich_interactive_domain-containing_protein_5B-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001822 P kidney development
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006807 P nitrogen compound metabolic process
GO:0008584 P male gonad development
GO:0008585 P female gonad development
GO:0009791 P post-embryonic development
GO:0010761 P fibroblast migration
GO:0030325 P adrenal gland development
GO:0035264 P multicellular organism growth
GO:0044212 F transcription cis-regulatory region binding
GO:0045444 P fat cell differentiation
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048468 P cell development
GO:0048644 P muscle organ morphogenesis
GO:0048705 P skeletal system morphogenesis
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060021 P roof of mouth development
GO:0060325 P face morphogenesis
GO:0060612 P adipose tissue development
GO:0060613 P fat pad development
RNA-seq EntryA_TrvaMG_comp11507_c0_seq1
Sequence
(Amino Acid)
MEKPFFRLVGAPCGQHGQYTFYKALRLTGPKEKIIAIGDFFFVRVWQDSELVSIGELQLL
WTDRVSDQTLVSLRLYFLPENTPDGRNLQGEDEVLAINDKVVLRAEDLLTWISDGASWHW
GLRAVWRGACAPPADLRHTQALHHTKLDFSDVEREKNSIAVDADSPGVVVFSYPRYCRYR
ALLSRLEGIQADWLRDSLVAALGGYAAP
(68 a.a.)

- SilkBase 1999-2023 -