SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG223_5prime_partial:A_TrvaMG_comp11504_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_E3_ubiquitin-protein_ligase_LRSAM1-like_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005876 C spindle microtubule
GO:0006915 P apoptotic process
GO:0008270 F zinc ion binding
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0031398 P positive regulation of protein ubiquitination
GO:0034121 P regulation of toll-like receptor signaling pathway
GO:0042326 P negative regulation of phosphorylation
GO:0042981 P regulation of apoptotic process
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0046872 F metal ion binding
GO:0060544 P regulation of necroptotic process
GO:0060546 P negative regulation of necroptotic process
GO:0070266 P necroptotic process
GO:0090307 P mitotic spindle assembly
GO:1990001 P inhibition of cysteine-type endopeptidase activity involved in apoptotic process
GO:2000378 P negative regulation of reactive oxygen species metabolic process
RNA-seq EntryA_TrvaMG_comp11504_c0_seq1
Sequence
(Amino Acid)
ANYLLQEGVIHCLPFLVKFLFSGDVISNITLEKLKDSGVSLSADREAILRAIYYYIGNNA
NANNDECSCVEPSAPIENTDENNCTGVVNTTDESTSESECVICMDAKCEVVFVPCGHMCC
CKNCGAGLEECPMCRGSIERTIKVMMA
*(48 a.a.)

- SilkBase 1999-2023 -