EntryView

ORF from Assembled RNA_seq Entry

Name

O_TrvaMG211_3prime_partial:A_TrvaMG_comp11477_c0_seq1

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_transcription_initiation_factor_TFIID_subunit_1_isoform_X2_[Amyelois_transitella]

Ontology

GO:0000166	F	nucleotide binding
GO:0001075	F	RNA polymerase II general transcription initiation factor activity
GO:0001129	F	obsolete RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly
GO:0003677	F	DNA binding
GO:0004402	F	histone acetyltransferase activity
GO:0004672	F	protein kinase activity
GO:0004674	F	protein serine/threonine kinase activity
GO:0005524	F	ATP binding
GO:0005634	C	nucleus
GO:0005654	C	nucleoplasm
GO:0005669	C	transcription factor TFIID complex
GO:0005730	C	nucleolus
GO:0006351	P	transcription, DNA-templated
GO:0006352	P	DNA-templated transcription, initiation
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006367	P	transcription initiation from RNA polymerase II promoter
GO:0006461	P	protein-containing complex assembly
GO:0006468	P	protein phosphorylation
GO:0007049	P	cell cycle
GO:0007221	P	positive regulation of transcription of Notch receptor target
GO:0008134	F	transcription factor binding
GO:0016301	F	kinase activity
GO:0016310	P	phosphorylation
GO:0016573	P	histone acetylation
GO:0016740	F	transferase activity
GO:0022008	P	neurogenesis
GO:0043565	F	sequence-specific DNA binding
GO:0044212	F	transcription cis-regulatory region binding
GO:0045944	P	positive regulation of transcription by RNA polymerase II
GO:0046425	P	regulation of receptor signaling pathway via JAK-STAT
GO:0051123	P	RNA polymerase II preinitiation complex assembly
GO:0051726	P	regulation of cell cycle
GO:0060261	P	positive regulation of transcription initiation from RNA polymerase II promoter

RNA-seq Entry

Sequence
(Amino Acid)

MCDSDDPGDHSRGLDLTGFLFGNIDERGQLEDDGLLDGDSKRMLSSLSRLGLGSMISEVL
DVEEPIREDEEKDYNNKSPSAVDFFDIEDAAEDIRTDNTETKGQFDNSMGGSHNISDTDI
AGEQEVQSTND
(42 a.a.)

- SilkBase 1999-2023 -