SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG211_3prime_partial:A_TrvaMG_comp11477_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_transcription_initiation_factor_TFIID_subunit_1_isoform_X2_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0001075 F RNA polymerase II general transcription initiation factor activity
GO:0001129 F obsolete RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly
GO:0003677 F DNA binding
GO:0004402 F histone acetyltransferase activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005669 C transcription factor TFIID complex
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006461 P protein-containing complex assembly
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007221 P positive regulation of transcription of Notch receptor target
GO:0008134 F transcription factor binding
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0022008 P neurogenesis
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0051123 P RNA polymerase II preinitiation complex assembly
GO:0051726 P regulation of cell cycle
GO:0060261 P positive regulation of transcription initiation from RNA polymerase II promoter
RNA-seq EntryA_TrvaMG_comp11477_c0_seq1
Sequence
(Amino Acid)
MCDSDDPGDHSRGLDLTGFLFGNIDERGQLEDDGLLDGDSKRMLSSLSRLGLGSMISEVL
DVEEPIREDEEKDYNNKSPSAVDFFDIEDAAEDIRTDNTETKGQFDNSMGGSHNISDTDI
AGEQEVQSTND
(42 a.a.)

- SilkBase 1999-2023 -