SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG18308_5prime_partial:A_TrvaMG_comp27322_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0003724 F RNA helicase activity
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006396 P RNA processing
GO:0008186 F ATP-dependent activity, acting on RNA
GO:0010501 P RNA secondary structure unwinding
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0030331 F estrogen receptor binding
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:2001014 P regulation of skeletal muscle cell differentiation
RNA-seq EntryA_TrvaMG_comp27322_c0_seq4
Sequence
(Amino Acid)
LERANINILQIIDVCMEYEKETKLSTLLKEIMAEKENKTIIFIETKRRVDDITRKMKRDG
WPAVCIHGDKSQNERDWVLQGGELRPSGACGAAAARSRA
*(32 a.a.)

- SilkBase 1999-2023 -