SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG18180_complete:A_TrvaMG_comp27315_c10_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004705 F JUN kinase activity
GO:0004707 F MAP kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007258 P JUN phosphorylation
GO:0007369 P gastrulation
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007507 P heart development
GO:0007552 P metamorphosis
GO:0008134 F transcription factor binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008293 P torso signaling pathway
GO:0008340 P determination of adult lifespan
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0008595 P anterior/posterior axis specification, embryo
GO:0009267 P cellular response to starvation
GO:0016242 P negative regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0030054 C cell junction
GO:0031594 C neuromuscular junction
GO:0034334 P adherens junction maintenance
GO:0034614 P cellular response to reactive oxygen species
GO:0043066 P negative regulation of apoptotic process
GO:0045467 P R7 cell development
GO:0045500 P sevenless signaling pathway
GO:0046534 P positive regulation of photoreceptor cell differentiation
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0048149 P behavioral response to ethanol
GO:0050803 P regulation of synapse structure or activity
GO:0050804 P modulation of chemical synaptic transmission
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071243 P cellular response to arsenic-containing substance
GO:0071276 P cellular response to cadmium ion
GO:0090303 P positive regulation of wound healing
GO:2000826 P regulation of heart morphogenesis
GO:2001023 P regulation of response to drug
RNA-seq EntryA_TrvaMG_comp27315_c10_seq1
Sequence
(Amino Acid)
MAEAAGVTSTNPNAEIIRGQVFEVGPRYTSLQYIGEGAYGMVVSAFDNVKKTKVAIKKIS
PFEHQTYCQRTLREIKILTRFKHENIIDIRDILRAETIDQMKDVYIVQCLMETDLYKLLK
TQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGVLGSPSQEDLDCIINEKARGYLESLPFKPRVPWVDLFPGADPRALDLLHRMLTFN
PHKRITVEEALAHPYLEQYYDPNDEPVAEEPFRFAMELDDLPKETLKKYIFEETLLFKQL
NEDA
*(120 a.a.)

- SilkBase 1999-2023 -