SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG18122_complete:A_TrvaMG_comp27311_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001736 P establishment of planar polarity
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007254 P JNK cascade
GO:0007281 P germ cell development
GO:0007297 P ovarian follicle cell migration
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007464 P R3/R4 cell fate commitment
GO:0008134 F transcription factor binding
GO:0009611 P response to wounding
GO:0009790 P embryo development
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0019730 P antimicrobial humoral response
GO:0031660 P obsolete regulation of cyclin-dependent protein serine/threonine kinase activity involved in G2/M transition of mitotic cell cycle
GO:0035220 P wing disc development
GO:0042060 P wound healing
GO:0043565 F sequence-specific DNA binding
GO:0045475 P locomotor rhythm
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046529 P imaginal disc fusion, thorax closure
GO:0046982 F protein heterodimerization activity
GO:0048674 P collateral sprouting of injured axon
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0070491 F DNA-binding transcription factor binding
RNA-seq EntryA_TrvaMG_comp27311_c0_seq3
Sequence
(Amino Acid)
MQNIDPLEIANILATELWCQQLANLEGLQSGVPTRTTATITPTQLRNFEQTYIELTNCRS
EPTTHVGFVPPSVTHANSYGILNTVGGYCDSGPTTALHVSPGPLSASGDSSSSPGLPAPK
RRNMGGRRPNKAPQELSPEEEERRKIRRERNKMAAARCRKRRLDHTNELQDETDRLEQKR
QSLQEEIRKLNADREHLQTILQNHMVTCRLSDRSSSPPDVKPLQEIYSYPEPEDGVRVKI
EVIEPAVDPVMALDNIFTTPSTEKRIMLSSANPGVVTSSGVITLDTPPAISRPNRPNSLH
VPLTLTPAQIHNNKALGNSKIAGVEISTPSNGMFNFDSIMEGGTGLTPVLPHPHHPYAAP
PRPAPAADHELVSL
*(124 a.a.)

- SilkBase 1999-2023 -