SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG18046_complete:A_TrvaMG_comp27298_c0_seq15
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003682 F chromatin binding
GO:0005102 F signaling receptor binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005956 C protein kinase CK2 complex
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0008134 F transcription factor binding
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016055 P Wnt signaling pathway
GO:0019887 F protein kinase regulator activity
GO:0019904 F protein domain specific binding
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0031519 C PcG protein complex
GO:0032927 P positive regulation of activin receptor signaling pathway
GO:0033211 P adiponectin-activated signaling pathway
GO:0042802 F identical protein binding
GO:0043537 P negative regulation of blood vessel endothelial cell migration
GO:0045859 P regulation of protein kinase activity
GO:0046872 F metal ion binding
GO:0061154 P endothelial tube morphogenesis
GO:0070062 C extracellular exosome
RNA-seq EntryA_TrvaMG_comp27298_c0_seq15
Sequence
(Amino Acid)
MSSSEEVSWISWFCGLRGNEFFCEVDEDYINDKFNLTGLNEQVPHYREALDMILDLEPDD
DIEDNPNESDLVEQASEILYGLIHARYILTNRGISQMLDKFQSGDFGYCPRVYCECQPML
PIGLSDVPAEAMVKLYCPRCMDVYTPKSSRHHHTDGAYFGTGFPHMVFMVHPERRPKRPA
SQFVPRLYGFKIHPLAYQIQQSAANSKPPKLSLSYNNGKR
*(72 a.a.)

- SilkBase 1999-2023 -