SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG18021_complete:A_TrvaMG_comp27296_c2_seq5
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002376 P immune system process
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005876 C spindle microtubule
GO:0006915 P apoptotic process
GO:0006964 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0007423 P sensory organ development
GO:0008270 F zinc ion binding
GO:0009966 P regulation of signal transduction
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0031625 F ubiquitin protein ligase binding
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043281 P regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045087 P innate immune response
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050829 P defense response to Gram-negative bacterium
GO:0061057 P peptidoglycan recognition protein signaling pathway
GO:0061630 F ubiquitin protein ligase activity
GO:0070534 P protein K63-linked ubiquitination
GO:0070936 P protein K48-linked ubiquitination
GO:0089720 F caspase binding
GO:0090307 P mitotic spindle assembly
GO:1990001 P inhibition of cysteine-type endopeptidase activity involved in apoptotic process
RNA-seq EntryA_TrvaMG_comp27296_c2_seq5
Sequence
(Amino Acid)
MSSPSDTPPIHSPPETGNDANTQSAGAAHNERLLSMGGTWRALGVVSGGARYPQYASLAS
RLATYDCWPTDKQQTPKDLSEAGFFHTGTDDQVRCFHCDGGLGKWEPGDAPWTEHARWFP
HCGYVLLLKGNDFVEECKNDNRRANTRETVVAPRRRYQGVNFPVIDEEVEECMESPITLA
VLGAGLDVARVRRAIIQRLRTTGSPFQTSEALIDSVLDAQLNEEDWSSNRESQSLSRHLS
DTLRSPDSIPGLSNTWDNVDTQLVPETTSVSPTTEPMTSTAVPSTSPGRSVDKEKVDVVV
LREEHLTLEEENRQLREARMCKVCMDNEVSVVFLPCGHLVSCARCGAALSACPLCRGAVR
ALVRAYLA
*(122 a.a.)

- SilkBase 1999-2023 -