SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG177_internal:A_TrvaMG_comp11407_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
AF117898_1_putative_hedgehog_receptor_[Junonia_coenia]
Ontology
GO:0001746 P Bolwig's organ morphogenesis
GO:0004888 F transmembrane signaling receptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005929 C cilium
GO:0006508 P proteolysis
GO:0006898 P receptor-mediated endocytosis
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007346 P regulation of mitotic cell cycle
GO:0007350 P blastoderm segmentation
GO:0007367 P segment polarity determination
GO:0007411 P axon guidance
GO:0007422 P peripheral nervous system development
GO:0007455 P eye-antennal disc morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008158 F hedgehog receptor activity
GO:0008406 P gonad development
GO:0009880 P embryonic pattern specification
GO:0009952 P anterior/posterior pattern specification
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0030139 C endocytic vesicle
GO:0030228 F lipoprotein particle receptor activity
GO:0030707 P ovarian follicle cell development
GO:0035225 P determination of genital disc primordium
GO:0042078 P germ-line stem cell division
GO:0042306 P regulation of protein import into nucleus
GO:0042981 P regulation of apoptotic process
GO:0045169 C fusome
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0048099 P anterior/posterior lineage restriction, imaginal disc
GO:0048100 P wing disc anterior/posterior pattern formation
GO:0048103 P somatic stem cell division
GO:0048471 C perinuclear region of cytoplasm
GO:0048477 P oogenesis
GO:0055088 P lipid homeostasis
GO:2000274 P regulation of epithelial cell migration, open tracheal system
RNA-seq EntryA_TrvaMG_comp11407_c0_seq1
Sequence
(Amino Acid)
PLDCFWEGSKLLGPDYPIHVPDLKQKLQWTHLNPQEVLDEVKKLKFQFPYGTVEAYMKRA
GITSAYMKKPCLDPNDAHCPSTAPNRKSRHVPDVAAELSHGCYGFAAAYMHWPEQLIVGG
ATRNSTSVLRSAKALQSVVQLMGEREMYEYWADHYKVHHVGWTQEKAAAVLDSWQRKFAA
EVRKMTNSGKVSNAYSFYPFSTSTLNDILGKFSELSLKNIILGYVFMLIYVSITLMQWSN
PVRSQAGVGIAGVMLLSITVAAGLGLCALLGIPFNASSTQIVPFLALGLGVQDMFLLTHT
YVEQAGEVPREERTGLVLKKSGLSVLLASLCNVMAFLAAALLP
(113 a.a.)

- SilkBase 1999-2023 -