SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG17602_complete:A_TrvaMG_comp27253_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0005911 C cell-cell junction
GO:0005925 C focal adhesion
GO:0006897 P endocytosis
GO:0008092 F cytoskeletal protein binding
GO:0008289 F lipid binding
GO:0016020 C membrane
GO:0019898 C extrinsic component of membrane
GO:0030036 P actin cytoskeleton organization
GO:0030100 P regulation of endocytosis
GO:0030659 C cytoplasmic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0032587 C ruffle membrane
GO:0036010 P protein localization to endosome
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043231 C intracellular membrane-bounded organelle
GO:0045806 P negative regulation of endocytosis
GO:0048858 P cell projection morphogenesis
GO:0055038 C recycling endosome membrane
GO:0070062 C extracellular exosome
GO:0070300 F phosphatidic acid binding
GO:0070836 P caveola assembly
GO:0072584 P caveolin-mediated endocytosis
GO:0097320 P plasma membrane tubulation
RNA-seq EntryA_TrvaMG_comp27253_c1_seq1
Sequence
(Amino Acid)
MSHHSDEHALLTTTSDSFWEPGNYKRTTKRVDDGHRLCSELQTLVQERAEIEKAYAKSLR
GWAKKWNDLIEKGPEYGTMEAAWKGSMVEAERLSDLHLSVRDRLVNDVMAQIKNWQKETY
HKDQNEGGYIFGHGPL
*(44 a.a.)

- SilkBase 1999-2023 -