SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG17322_complete:A_TrvaMG_comp27217_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001558 P regulation of cell growth
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008283 P cell population proliferation
GO:0008361 P regulation of cell size
GO:0009792 P embryo development ending in birth or egg hatching
GO:0009880 P embryonic pattern specification
GO:0010506 P regulation of autophagy
GO:0010906 P regulation of glucose metabolic process
GO:0022008 P neurogenesis
GO:0030307 P positive regulation of cell growth
GO:0035212 P cell competition in a multicellular organism
GO:0035363 C histone locus body
GO:0040018 P positive regulation of multicellular organism growth
GO:0042023 P DNA endoreduplication
GO:0042594 P response to starvation
GO:0042981 P regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043565 F sequence-specific DNA binding
GO:0044719 P regulation of imaginal disc-derived wing size
GO:0045572 P positive regulation of imaginal disc growth
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045793 P positive regulation of cell size
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045927 P positive regulation of growth
GO:0046620 P regulation of organ growth
GO:0046983 F protein dimerization activity
GO:0048477 P oogenesis
GO:0048639 P positive regulation of developmental growth
GO:0050769 P positive regulation of neurogenesis
GO:0051726 P regulation of cell cycle
GO:0055088 P lipid homeostasis
GO:0090062 P regulation of trehalose metabolic process
GO:0090277 P positive regulation of peptide hormone secretion
RNA-seq EntryA_TrvaMG_comp27217_c0_seq2
Sequence
(Amino Acid)
MLVRSDTVVRTASMPDRRQAQRPVESATSRTARSPPRGIARKRLVPPASIASGGSRRRAR
GPGRRGRRSNTDTDSEAESLTNDRRFIHNDMERQRRIGLKNLFDELKMQIPATRDKERAP
KVVILREAAALCRKLSQEDIEREKLRKRQNQLMARLKKLRKSLSARYHSY
*(56 a.a.)

- SilkBase 1999-2023 -