SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG17304_complete:A_TrvaMG_comp27215_c3_seq6
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0001662 P behavioral fear response
GO:0003009 P skeletal muscle contraction
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004711 F ribosomal protein S6 kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005829 C cytosol
GO:0006417 P regulation of translation
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0007281 P germ cell development
GO:0007568 P aging
GO:0007584 P response to nutrient
GO:0007616 P long-term memory
GO:0009408 P response to heat
GO:0009611 P response to wounding
GO:0009612 P response to mechanical stimulus
GO:0009636 P response to toxic substance
GO:0009749 P response to glucose
GO:0009986 C cell surface
GO:0010033 P response to organic substance
GO:0010243 P response to organonitrogen compound
GO:0014070 P response to organic cyclic compound
GO:0014732 P skeletal muscle atrophy
GO:0014878 P response to electrical stimulus involved in regulation of muscle adaptation
GO:0014911 P positive regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0030054 C cell junction
GO:0030165 F PDZ domain binding
GO:0031929 P TOR signaling
GO:0032496 P response to lipopolysaccharide
GO:0032868 P response to insulin
GO:0032870 P cellular response to hormone stimulus
GO:0033574 P response to testosterone
GO:0033762 P response to glucagon
GO:0034612 P response to tumor necrosis factor
GO:0042277 F peptide binding
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0043005 C neuron projection
GO:0043066 P negative regulation of apoptotic process
GO:0043200 P response to amino acid
GO:0043201 P response to leucine
GO:0043434 P response to peptide hormone
GO:0043491 P protein kinase B signaling
GO:0045202 C synapse
GO:0045471 P response to ethanol
GO:0045727 P positive regulation of translation
GO:0045931 P positive regulation of mitotic cell cycle
GO:0045948 P positive regulation of translational initiation
GO:0046324 P regulation of glucose import
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0048471 C perinuclear region of cytoplasm
GO:0048633 P positive regulation of skeletal muscle tissue growth
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0051384 P response to glucocorticoid
GO:0051721 F protein phosphatase 2A binding
GO:0071363 P cellular response to growth factor stimulus
GO:0071407 P cellular response to organic cyclic compound
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_TrvaMG_comp27215_c3_seq6
Sequence
(Amino Acid)
MSSYMAGVFDLDLEVDTVTVADSDEDDIIDVDEVDYEPELHVNSIVESEGSETIQLCEDT
VNPGQCKRLGPQDFELRKVLGKGGYGKVFQVRKITGPDAGAHFAMKVLKKASIVRNQKDT
AHTKAERNILEAVKHPFIVELVYAFQTGGKLYLILEYLSGGELFMHLEREGIFLEDTACF
YLSEIILALEHLHSLGIIYRDLKPENVLLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTI
EYMAPEILTRSGHGKAVDWWSLGALMYDMLIGQPPYTGDNRTKTIEKILKGKLVLPAYLT
QDARDLIRRLMKRSETQRLGAAGAAAVRGHAFFKHVHWDDVFARRLEPPIKPRLTSEDDV
SQFDTRFTLQTPIDSPDESTLSESANLMFQV
*(129 a.a.)

- SilkBase 1999-2023 -