| Name | O_TrvaMG171_3prime_partial:A_TrvaMG_comp11396_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_LOW_QUALITY_PROTEIN:_treacle_protein_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0002039 |
F |
p53 binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0006974 |
P |
cellular response to DNA damage stimulus |
| GO:0007155 |
P |
cell adhesion |
| GO:0015630 |
C |
microtubule cytoskeleton |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0030155 |
P |
regulation of cell adhesion |
| GO:0035507 |
P |
regulation of myosin-light-chain-phosphatase activity |
| GO:0035556 |
P |
intracellular signal transduction |
| GO:2000772 |
P |
regulation of cellular senescence |
|
| RNA-seq Entry | A_TrvaMG_comp11396_c0_seq1 |
Sequence
(Amino Acid) | MVVGENKRTANIMDGIENTGDVRMHDHRLRLKQRFDIVRKLGQGTYGKVQLGINKKTGQE
VAIKTIKKCKIESEADLIRIRREVQIMSSVRHPNIVHIYEVFENSEKMILVMEYCSGGEL
YDYLSQRKVLQEDEARRLFRQIATAVYYCHIHKICHRDLKLENVLLDDTGSAKIADFGL
(58 a.a.) |
