SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG16719_complete:A_TrvaMG_comp27155_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000118 C histone deacetylase complex
GO:0000209 P protein polyubiquitination
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003779 F actin binding
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005881 C cytoplasmic microtubule
GO:0005901 C caveola
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006476 P protein deacetylation
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006515 P protein quality control for misfolded or incompletely synthesized proteins
GO:0006886 P intracellular protein transport
GO:0007026 P negative regulation of microtubule depolymerization
GO:0008013 F beta-catenin binding
GO:0008017 F microtubule binding
GO:0008270 F zinc ion binding
GO:0009636 P response to toxic substance
GO:0009967 P positive regulation of signal transduction
GO:0010033 P response to organic substance
GO:0010469 P regulation of signaling receptor activity
GO:0010634 P positive regulation of epithelial cell migration
GO:0010870 P obsolete positive regulation of receptor biosynthetic process
GO:0016234 C inclusion body
GO:0016235 C aggresome
GO:0016236 P macroautophagy
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016787 F hydrolase activity
GO:0030286 C dynein complex
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031252 C cell leading edge
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031647 P regulation of protein stability
GO:0032041 F NAD-dependent histone deacetylase activity (H3-K14 specific)
GO:0032418 P lysosome localization
GO:0034983 P peptidyl-lysine deacetylation
GO:0035967 P cellular response to topologically incorrect protein
GO:0040029 P regulation of gene expression, epigenetic
GO:0042826 F histone deacetylase binding
GO:0042903 F tubulin deacetylase activity
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043014 F alpha-tubulin binding
GO:0043130 F ubiquitin binding
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043204 C perikaryon
GO:0043234 C protein-containing complex
GO:0043241 P protein-containing complex disassembly
GO:0043242 P negative regulation of protein-containing complex disassembly
GO:0044297 C cell body
GO:0045598 P regulation of fat cell differentiation
GO:0045861 P negative regulation of proteolysis
GO:0046872 F metal ion binding
GO:0048156 F tau protein binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048487 F beta-tubulin binding
GO:0048668 P collateral sprouting
GO:0051646 P mitochondrion localization
GO:0051787 F misfolded protein binding
GO:0051788 P response to misfolded protein
GO:0051879 F Hsp90 protein binding
GO:0060997 P dendritic spine morphogenesis
GO:0070201 P regulation of establishment of protein localization
GO:0070301 P cellular response to hydrogen peroxide
GO:0070840 F dynein complex binding
GO:0070842 P aggresome assembly
GO:0070845 P polyubiquitinated misfolded protein transport
GO:0070846 P Hsp90 deacetylation
GO:0070848 P response to growth factor
GO:0070932 P histone H3 deacetylation
GO:0071218 P cellular response to misfolded protein
GO:0090035 P positive regulation of chaperone-mediated protein complex assembly
GO:0090042 P tubulin deacetylation
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:1901300 P positive regulation of hydrogen peroxide-mediated programmed cell death
RNA-seq EntryA_TrvaMG_comp27155_c0_seq1
Sequence
(Amino Acid)
MATPPPAQGRKSGGDNKKVTPPTSNIVTRNGARKAKIQTRAMSAATKPSANLLAAKKRQQ
QKKKQNHFIMEIRDHYQIAMESKNLVKGPTGFVTEPRMAEHRCLWDENYPECPERLISVI
NRCQELNLIEQCKQFEPRAATKDELCTLHSPSVYELMETTHNNEDVNYLEEVSSKFDAVY
IHPSTHELALISAGCTIDMVDNILSGSVQNGAAFVRPPGHHAMYSEPCGYCFYNNVALAA
KHALDNRGLQRILIVDWDVHHGQATQQMFYDDPRVVYFSIHRYEHGSFWPQLRQSDYHYV
GSGAGKGYNFNVPLNKTGMKDGDYLAIWHQLLLPMAFEFSPELVLVSAGYDSALGDEKGE
MELSPSCYASLVHMLSCVCARVCVVLEGGYCVTSLAEGAALTLRTLLGYPPPKLVDVTSP
SDEIRSTILNCIYAHKQYWSCYQHQPTYTTQGAPNVCDTNKQKHVVCVRWEGDETRPDRF
ETRDCYPMQDDNTKRVLEDRLRQLRLATDLSVPTHAVGYVYDQLMLKHKNIVEPGHVECP
ERIMRIHERHRDYNLLDRLHHINGRMATDEEILRIHSDKYLDSLKDLASTKLRELHHLKD
KYDSVYFHPESLESAAVAAGCVLQAVDAVTSRACGACVCVVRPPGHHAHSDTPAGFCLLN
NAALGAAHALTRALTRAHTHAHTHARMLLLDWDVHHGNGTQAVTYDNDQILYISIHRYDD
GSFFPHSKNADYTAVGTGKGEGYNVNIPWNKRGMGDVEYMAAFTQIVLPIAYEYNPDLVI
VSAGFDACVGDPLGGCKVTPECYGRMTQLLRGLAGGKVILCLEGGYNITSISYAMTMCTK
ALLGDPILHHYEPKTTCHWSAIETINNVISTHKKYWKSLAFQVALPAENVLDPPLPSRGL
SDLSDTFSSFEKSESKDNSIDSLLEFNMANLSLNKSNDESKNSNFESKCEDGVHCGTDDE
DKPSASSNSNLERASNKCEDGLHCGTDDEDEKQNTPTNSNLDSNSKTKEEDKAVSNLESS
NENKTLVDFLSENMQAIVNEEMFAVVPMPWCPHLDSLYAIPNDVKFEQGVKCVDCDHTVE
NWVCLHCYVTACARSVNAHMQSHYTRTQHALVLSLSDLSVWCNVCDAYVDNALLYDAKNN
AHRCKFQQDMPWCYATDVLELR
*(386 a.a.)

- SilkBase 1999-2023 -