SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG16693_5prime_partial:A_TrvaMG_comp27148_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0005886 C plasma membrane
GO:0007067 P mitotic cell cycle
GO:0007301 P female germline ring canal formation
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007611 P learning or memory
GO:0008045 P motor neuron axon guidance
GO:0008104 P protein localization
GO:0008302 P female germline ring canal formation, actin assembly
GO:0008340 P determination of adult lifespan
GO:0008355 P olfactory learning
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0030708 P germarium-derived female germ-line cyst encapsulation
GO:0030725 P germline ring canal formation
GO:0035182 C female germline ring canal outer rim
GO:0035183 C female germline ring canal inner rim
GO:0035204 P negative regulation of lamellocyte differentiation
GO:0035324 C female germline ring canal
GO:0045179 C apical cortex
GO:0048149 P behavioral response to ethanol
GO:0048471 C perinuclear region of cytoplasm
GO:0051015 F actin filament binding
GO:0051495 P positive regulation of cytoskeleton organization
GO:0070938 C contractile ring
RNA-seq EntryA_TrvaMG_comp27148_c0_seq1
Sequence
(Amino Acid)
AAQKQGPVLPHFKSDASKVTSKGMGLKKAYLNKHNQFTVHAGDAGTNILYVGIYGPKGPC
DEVQLKHKGKNNYECWYVVRDRGDYIVIVKWGDDHIPGSPYKVEV
*(34 a.a.)

- SilkBase 1999-2023 -