SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG16330_complete:A_TrvaMG_comp27118_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001921 P positive regulation of receptor recycling
GO:0005198 F structural molecule activity
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0007155 P cell adhesion
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0007519 P skeletal muscle tissue development
GO:0008360 P regulation of cell shape
GO:0010842 P retina layer formation
GO:0014866 P skeletal myofibril assembly
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0016328 C lateral plasma membrane
GO:0030054 C cell junction
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0040017 P positive regulation of locomotion
GO:0042383 C sarcolemma
GO:0042462 P eye photoreceptor cell development
GO:0043087 P regulation of GTPase activity
GO:0045216 P cell-cell junction organization
GO:0060041 P retina development in camera-type eye
GO:0060047 P heart contraction
GO:0060429 P epithelium development
GO:0061436 P establishment of skin barrier
GO:0070830 P bicellular tight junction assembly
GO:0090136 P epithelial cell-cell adhesion
GO:0090504 P epiboly
RNA-seq EntryA_TrvaMG_comp27118_c0_seq2
Sequence
(Amino Acid)
MSFYPEYSTISTLDDRTFQVSIMAMEESRVLVWHRDKLKLSIMSDGFLQAVFDHILGRDV
VHKLMQVSETMAVSNGHLPNSYEEGEDKPMLVVKKAGDGPGITAILNRQLQATDPNAWRL
GRIEEADHETPV
*(43 a.a.)

- SilkBase 1999-2023 -