SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG16306_complete:A_TrvaMG_comp27115_c6_seq29
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000791 C euchromatin
GO:0001933 P negative regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0005515 F protein binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006041 P glucosamine metabolic process
GO:0006110 P regulation of glycolytic process
GO:0006486 P protein glycosylation
GO:0006493 P protein O-linked glycosylation
GO:0006915 P apoptotic process
GO:0008134 F transcription factor binding
GO:0008289 F lipid binding
GO:0010628 P positive regulation of gene expression
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0016020 C membrane
GO:0016262 F protein N-acetylglucosaminyltransferase activity
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0019904 F protein domain specific binding
GO:0030900 P forebrain development
GO:0031397 P negative regulation of protein ubiquitination
GO:0032869 P cellular response to insulin stimulus
GO:0032922 P circadian regulation of gene expression
GO:0033137 P negative regulation of peptidyl-serine phosphorylation
GO:0042277 F peptide binding
GO:0042588 C zymogen granule
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043981 P histone H4-K5 acetylation
GO:0043982 P histone H4-K8 acetylation
GO:0043984 P histone H4-K16 acetylation
GO:0043995 F histone acetyltransferase activity (H4-K5 specific)
GO:0043996 F histone acetyltransferase activity (H4-K8 specific)
GO:0045793 P positive regulation of cell size
GO:0045862 P positive regulation of proteolysis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046972 F histone acetyltransferase activity (H4-K16 specific)
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0048029 F monosaccharide binding
GO:0048312 P intracellular distribution of mitochondria
GO:0048511 P rhythmic process
GO:0060548 P negative regulation of cell death
GO:0061087 P positive regulation of histone H3-K27 methylation
GO:0070207 P protein homotrimerization
GO:0070208 P protein heterotrimerization
GO:0071222 P cellular response to lipopolysaccharide
GO:0071333 P cellular response to glucose stimulus
GO:0080182 P histone H3-K4 trimethylation
GO:0090315 P negative regulation of protein targeting to membrane
GO:0090526 P regulation of gluconeogenesis
GO:0097237 P cellular response to toxic substance
GO:0097363 F protein O-GlcNAc transferase activity
GO:1900038 P negative regulation of cellular response to hypoxia
GO:1900182 P positive regulation of protein localization to nucleus
GO:1903428 P positive regulation of reactive oxygen species biosynthetic process
RNA-seq EntryA_TrvaMG_comp27115_c6_seq29
Sequence
(Amino Acid)
MITKMQPQANVAVPQSVTTQPQAQQIVGVPANAVILKMSDLQQISTVGLLELAHREYQAG
DYESAEHHCMQLWRQDNTNTGVLLLLSSIHFQCRRLDKSAHFSTLAIKQNPLLAEAYSNL
GNVYKERGQLQEALENYRHAVRLKPDFIDGYINLAAALVAAGDMEQAVQAYVTALQYNPD
LYCVRSDLGNLLKALGRLDEAKVKWTKV
*(68 a.a.)

- SilkBase 1999-2023 -