SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG16019_complete:A_TrvaMG_comp27073_c0_seq11
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001523 P retinoid metabolic process
GO:0001750 C photoreceptor outer segment
GO:0004012 F ATPase-coupled intramembrane lipid transporter activity
GO:0005215 F transporter activity
GO:0005395 F obsolete eye pigment precursor transporter activity
GO:0005524 F ATP binding
GO:0005548 F phospholipid transporter activity
GO:0005887 C integral component of plasma membrane
GO:0006649 P phospholipid transfer to membrane
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0007601 P visual perception
GO:0007603 P phototransduction, visible light
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0045332 P phospholipid translocation
GO:0045494 P photoreceptor cell maintenance
GO:0050896 P response to stimulus
GO:0055085 P transmembrane transport
GO:0097381 C photoreceptor disc membrane
RNA-seq EntryA_TrvaMG_comp27073_c0_seq11
Sequence
(Amino Acid)
MSVYDALELIAILRGVPKDQVKRELNNLIEALDLSNLAHTRIRRLLSADRNRVHFAAAVI
GAPPIVILDECTAYQKFFVQRAMYSILYALKKKGHSILISSSIVETHLPMTNRLFFIIDG
TTYDVGTVDEFVDRYSAKGYTVVVHLKDDVDVERMFRNHFENFVVNDTSEVGILQALN
*(58 a.a.)

- SilkBase 1999-2023 -