SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG1598_complete:A_TrvaMG_comp13557_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
microsomal_glutathione_S-transferase_[Antheraea_yamamai]
Ontology
GO:0004364 F glutathione transferase activity
GO:0004602 F glutathione peroxidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005743 C mitochondrial inner membrane
GO:0005778 C peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006749 P glutathione metabolic process
GO:0006805 P xenobiotic metabolic process
GO:0010243 P response to organonitrogen compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0032496 P response to lipopolysaccharide
GO:0033327 P Leydig cell differentiation
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0043295 F glutathione binding
GO:0045177 C apical part of cell
GO:0055114 P obsolete oxidation-reduction process
GO:0070207 P protein homotrimerization
GO:0071449 P cellular response to lipid hydroperoxide
GO:0098869 P cellular oxidant detoxification
GO:1901687 P glutathione derivative biosynthetic process
RNA-seq EntryA_TrvaMG_comp13557_c0_seq1
Sequence
(Amino Acid)
MSLNLSDPAVQSYILYSAILGLKIFVVTLLTARARYSKKVFANEEDAKPARGKVKYDDPD
VERVRRAHLNDLENIPVFWVLGALYLTTSPEAAWATMLFRLFTAGRILHTVVYAVKPLPQ
PARAIAFGIPFIITVYMGFKVVLHYITAL
*(49 a.a.)

- SilkBase 1999-2023 -