SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG15884_internal:A_TrvaMG_comp27054_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000123 C histone acetyltransferase complex
GO:0000785 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001159 F cis-regulatory region sequence-specific DNA binding
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001666 P response to hypoxia
GO:0001756 P somitogenesis
GO:0001889 P liver development
GO:0001934 P positive regulation of protein phosphorylation
GO:0002039 F p53 binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003712 F transcription coregulator activity
GO:0003713 F transcription coactivator activity
GO:0003823 F antigen binding
GO:0004402 F histone acetyltransferase activity
GO:0004468 F lysine N-acetyltransferase activity, acting on acetyl phosphate as donor
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006473 P protein acetylation
GO:0006475 P internal protein amino acid acetylation
GO:0006915 P apoptotic process
GO:0006990 P positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0007049 P cell cycle
GO:0007219 P Notch signaling pathway
GO:0007507 P heart development
GO:0007519 P skeletal muscle tissue development
GO:0007613 P memory
GO:0007623 P circadian rhythm
GO:0008013 F beta-catenin binding
GO:0008022 F protein C-terminus binding
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0009749 P response to glucose
GO:0009887 P animal organ morphogenesis
GO:0010560 P positive regulation of glycoprotein biosynthetic process
GO:0010628 P positive regulation of gene expression
GO:0010942 P positive regulation of cell death
GO:0014070 P response to organic cyclic compound
GO:0014737 P positive regulation of muscle atrophy
GO:0016407 F acetyltransferase activity
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0018076 P N-terminal peptidyl-lysine acetylation
GO:0018393 P internal peptidyl-lysine acetylation
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030183 P B cell differentiation
GO:0030220 P platelet formation
GO:0030307 P positive regulation of cell growth
GO:0030324 P lung development
GO:0031324 P negative regulation of cellular metabolic process
GO:0031325 P positive regulation of cellular metabolic process
GO:0031490 F chromatin DNA binding
GO:0032025 P response to cobalt ion
GO:0032092 P positive regulation of protein binding
GO:0032403 F protein-containing complex binding
GO:0032526 P response to retinoic acid
GO:0032967 P positive regulation of collagen biosynthetic process
GO:0032993 C protein-DNA complex
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0033613 F DNA-binding transcription factor binding
GO:0034612 P response to tumor necrosis factor
GO:0034644 P cellular response to UV
GO:0035066 P positive regulation of histone acetylation
GO:0035257 F nuclear receptor binding
GO:0035259 F glucocorticoid receptor binding
GO:0035690 P cellular response to xenobiotic stimulus
GO:0035855 P megakaryocyte development
GO:0035984 P cellular response to trichostatin A
GO:0042493 P response to xenobiotic stimulus
GO:0042542 P response to hydrogen peroxide
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042975 F peroxisome proliferator activated receptor binding
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043388 P positive regulation of DNA binding
GO:0043425 F bHLH transcription factor binding
GO:0043491 P protein kinase B signaling
GO:0043627 P response to estrogen
GO:0043923 P positive regulation by host of viral transcription
GO:0043966 P histone H3 acetylation
GO:0043967 P histone H4 acetylation
GO:0043969 P histone H2B acetylation
GO:0045444 P fat cell differentiation
GO:0045471 P response to ethanol
GO:0045727 P positive regulation of translation
GO:0045773 P positive regulation of axon extension
GO:0045793 P positive regulation of cell size
GO:0045862 P positive regulation of proteolysis
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0048565 P digestive tract development
GO:0050681 F androgen receptor binding
GO:0050714 P positive regulation of protein secretion
GO:0050821 P protein stabilization
GO:0051019 F mitogen-activated protein kinase binding
GO:0051059 F NF-kappaB binding
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051216 P cartilage development
GO:0051592 P response to calcium ion
GO:0060177 P regulation of angiotensin metabolic process
GO:0060298 P positive regulation of sarcomere organization
GO:0060548 P negative regulation of cell death
GO:0060765 P regulation of androgen receptor signaling pathway
GO:0065004 P protein-DNA complex assembly
GO:0070301 P cellular response to hydrogen peroxide
GO:0070542 P response to fatty acid
GO:0071236 P cellular response to antibiotic
GO:0071300 P cellular response to retinoic acid
GO:0071320 P cellular response to cAMP
GO:0071333 P cellular response to glucose stimulus
GO:0071389 P cellular response to mineralocorticoid stimulus
GO:0071407 P cellular response to organic cyclic compound
GO:0071548 P response to dexamethasone
GO:0071549 P cellular response to dexamethasone stimulus
GO:0090043 P regulation of tubulin deacetylation
GO:0097157 F pre-mRNA intronic binding
GO:1901985 P positive regulation of protein acetylation
GO:1990090 P cellular response to nerve growth factor stimulus
GO:1990405 F protein antigen binding
GO:2000629 P negative regulation of miRNA metabolic process
RNA-seq EntryA_TrvaMG_comp27054_c2_seq1
Sequence
(Amino Acid)
APRACAERGAGGPPPPPPLHHAPHMQRPPHHLHPAQPAQPPMQQPRGASPAGPQPQVHQK
ALQQLMATLRSPNSQNQQQEILHILKSNPQLMAAFIKQRQNAQNQQAGVGGVGSVGGVGG
VGGVGGVCGVPQQQPQLQHMMQPQQQRLQQMHQMLPQQPQVGGVSGVGTVGGVSNVGMSG
VGAGGVGGMSHGGAGGWFKQNAAGGVGMMNMRGAYGGVGGVGGGVGGVGGVGGGVGGAAR
LGGAGARYSAPRFEARSK
(85 a.a.)

- SilkBase 1999-2023 -