SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG157_complete:A_TrvaMG_comp11351_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_alkylated_DNA_repair_protein_alkB_homolog_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0001764 P neuron migration
GO:0001890 P placenta development
GO:0003824 F catalytic activity
GO:0003906 F DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005634 C nucleus
GO:0005719 C euchromatin
GO:0005739 C mitochondrion
GO:0006281 P DNA repair
GO:0006307 P DNA dealkylation involved in DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0008152 P metabolic process
GO:0008198 F ferrous iron binding
GO:0010468 P regulation of gene expression
GO:0016491 F oxidoreductase activity
GO:0016829 F lyase activity
GO:0030154 P cell differentiation
GO:0031175 P neuron projection development
GO:0042056 F chemoattractant activity
GO:0042245 P RNA repair
GO:0043524 P negative regulation of neuron apoptotic process
GO:0046872 F metal ion binding
GO:0048589 P developmental growth
GO:0050918 P positive chemotaxis
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070579 F methylcytosine dioxygenase activity
GO:0070989 P oxidative demethylation
GO:0080111 P DNA demethylation
RNA-seq EntryA_TrvaMG_comp11351_c0_seq1
Sequence
(Amino Acid)
MNSTLSAHTDHSEVNLDAPLFSFSFGQSAIFLLGGQEKSVEPSALLLNSGDIVVMSKEAR
LCYHAVPKILPEHQKPWNSDLSKLDDDCEIPTFKYISNANEVIKMMNENLDNDKWNVFKN
YIAESRINMNVRQVLHENQTSLDEEYFIEDIKS
*(50 a.a.)

- SilkBase 1999-2023 -