SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG15392_3prime_partial:A_TrvaMG_comp26981_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0006468 P protein phosphorylation
GO:0006914 P autophagy
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0008340 P determination of adult lifespan
GO:0008361 P regulation of cell size
GO:0009792 P embryo development ending in birth or egg hatching
GO:0012501 P programmed cell death
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030516 P regulation of axon extension
GO:0032880 P regulation of protein localization
GO:0040014 P regulation of multicellular organism growth
GO:0040024 P dauer larval development
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043277 P apoptotic cell clearance
GO:0045138 P nematode male tail tip morphogenesis
GO:0046777 P protein autophosphorylation
RNA-seq EntryA_TrvaMG_comp26981_c1_seq1
Sequence
(Amino Acid)
MSLKYDAKADLWSLGTIVYQCLTGKAPFQATTPHELKAFYENSVDLQPKIPPGTSPELCS
LLIGLLRRNPRERLSFEMFFNHPFLQRSRNTNLPKMGSCAGGSVVAGRAAPRDRASGTQL
APAHNKPLPTASADSCEGAWAGEEDFVLVEATDSGSAECSGASSGSEAAPRPRSLALPAP
P
(59 a.a.)

- SilkBase 1999-2023 -