SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG15324_5prime_partial:A_TrvaMG_comp26974_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0003091 P renal water homeostasis
GO:0004016 F adenylate cyclase activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006171 P cAMP biosynthetic process
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007212 P dopamine receptor signaling pathway
GO:0008294 F calcium- and calmodulin-responsive adenylate cyclase activity
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0010977 P negative regulation of neuron projection development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019901 F protein kinase binding
GO:0019933 P cAMP-mediated signaling
GO:0031226 C intrinsic component of plasma membrane
GO:0035556 P intracellular signal transduction
GO:0035811 P negative regulation of urine volume
GO:0042312 P blood vessel diameter maintenance
GO:0042995 C cell projection
GO:0046872 F metal ion binding
GO:0071380 P cellular response to prostaglandin E stimulus
GO:0071870 P cellular response to catecholamine stimulus
GO:0097110 F scaffold protein binding
GO:1904117 P cellular response to vasopressin
GO:1904322 P cellular response to forskolin
RNA-seq EntryA_TrvaMG_comp26974_c0_seq1
Sequence
(Amino Acid)
VCVCVCVCIYEAGVGVCVLRQVTHEVYELLAARGYRLRCRGTVDVKGKGNMVTYFLDGVG
DTIPQDLFTNPIPSTSGECHRGEHRPLDTLSEARTDEDAGPSPRTSIPMESDIESCIRRR
PVSLTESGAEVSSLLTSPSGAPLPRARSAPLADFVFRRRPNKSLLNATTLADTVHVIENP
MNALHDLHQQHFSPV
*(64 a.a.)

- SilkBase 1999-2023 -