SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG15280_5prime_partial:A_TrvaMG_comp26961_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0002151 F G-quadruplex RNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005844 C polysome
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0008266 F poly(U) RNA binding
GO:0010521 F telomerase inhibitor activity
GO:0015629 C actin cytoskeleton
GO:0016568 P chromatin organization
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0031011 C Ino80 complex
GO:0034046 F poly(G) binding
GO:0043204 C perikaryon
GO:0043981 P histone H4-K5 acetylation
GO:0043982 P histone H4-K8 acetylation
GO:0043984 P histone H4-K16 acetylation
GO:0043995 F histone acetyltransferase activity (H4-K5 specific)
GO:0043996 F histone acetyltransferase activity (H4-K8 specific)
GO:0046972 F histone acetyltransferase activity (H4-K16 specific)
GO:0051974 P negative regulation of telomerase activity
GO:0071339 C MLL1 complex
GO:1904357 P negative regulation of telomere maintenance via telomere lengthening
GO:1904751 P positive regulation of protein localization to nucleolus
RNA-seq EntryA_TrvaMG_comp26961_c0_seq3
Sequence
(Amino Acid)
LIRYCYMNVILLTLRSVGNNIIHLIEEKRSKERKQESYYSKSIAVGRSTRDHPIDVDLSL
EGPAAKVSRKQAIIRLRNSGEFFMSSEGKRPIFVDGRPILQGNKVKLNHNSVIEIAGLRF
VFLVNQDLISAIRQEAVKVTIPV
*(47 a.a.)

- SilkBase 1999-2023 -