SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG14615_complete:A_TrvaMG_comp26875_c2_seq10
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002165 P instar larval or pupal development
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0010369 C chromocenter
GO:0010385 F double-stranded methylated DNA binding
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030154 P cell differentiation
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0035220 P wing disc development
GO:0040029 P regulation of gene expression, epigenetic
GO:0044026 P DNA hypermethylation
GO:0045814 P negative regulation of gene expression, epigenetic
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0048132 P female germ-line stem cell asymmetric division
GO:0048477 P oogenesis
GO:0051038 P negative regulation of transcription involved in meiotic cell cycle
GO:0051567 P histone H3-K9 methylation
GO:0060968 P obsolete regulation of gene silencing
GO:0090309 P positive regulation of DNA methylation-dependent heterochromatin assembly
RNA-seq EntryA_TrvaMG_comp26875_c2_seq10
Sequence
(Amino Acid)
MPFIGKMPLYKNMGRNSKTDEQKKEQEKKKEEEKEKTVKEKEKPKDNVTDDCITISDDED
NMREPSRFTAQTGMGANEFVPKHRSVRDLYGEDEACYIMDAKVQGNIGRYLNHSCSPNVF
VQNVFVDTHDPRFPWVAFFALSHIRAGTELTWNYNYDVGSVPGKVLYCHCGAPNCRGRLL
*(59 a.a.)

- SilkBase 1999-2023 -