SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG13671_complete:A_TrvaMG_comp26680_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000902 P cell morphogenesis
GO:0001726 C ruffle
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0002433 P immune response-regulating cell surface receptor signaling pathway involved in phagocytosis
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006886 P intracellular protein transport
GO:0006909 P phagocytosis
GO:0006913 P nucleocytoplasmic transport
GO:0006974 P cellular response to DNA damage stimulus
GO:0007015 P actin filament organization
GO:0007017 P microtubule-based process
GO:0007164 P establishment of tissue polarity
GO:0007165 P signal transduction
GO:0007254 P JNK cascade
GO:0007264 P small GTPase mediated signal transduction
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007390 P germ-band shortening
GO:0007391 P dorsal closure
GO:0007394 P dorsal closure, elongation of leading edge cells
GO:0007395 P dorsal closure, spreading of leading edge cells
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0007413 P axonal fasciculation
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007435 P salivary gland morphogenesis
GO:0007516 P hemocyte development
GO:0007520 P myoblast fusion
GO:0008045 P motor neuron axon guidance
GO:0008078 P mesodermal cell migration
GO:0008258 P head involution
GO:0008283 P cell population proliferation
GO:0008347 P glial cell migration
GO:0010593 P negative regulation of lamellipodium assembly
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016028 C rhabdomere
GO:0016199 P axon midline choice point recognition
GO:0016203 P muscle attachment
GO:0016335 P morphogenesis of larval imaginal disc epithelium
GO:0016358 P dendrite development
GO:0019897 C extrinsic component of plasma membrane
GO:0019901 F protein kinase binding
GO:0030032 P lamellipodium assembly
GO:0030036 P actin cytoskeleton organization
GO:0030707 P ovarian follicle cell development
GO:0030866 P cortical actin cytoskeleton organization
GO:0031175 P neuron projection development
GO:0031532 P actin cytoskeleton reorganization
GO:0031941 C filamentous actin
GO:0032147 P activation of protein kinase activity
GO:0032794 F GTPase activating protein binding
GO:0034334 P adherens junction maintenance
GO:0035010 P encapsulation of foreign target
GO:0035011 P melanotic encapsulation of foreign target
GO:0035099 P hemocyte migration
GO:0035212 P cell competition in a multicellular organism
GO:0035320 P imaginal disc-derived wing hair site selection
GO:0042052 P rhabdomere development
GO:0042067 P establishment of ommatidial planar polarity
GO:0045216 P cell-cell junction organization
GO:0045610 P regulation of hemocyte differentiation
GO:0045773 P positive regulation of axon extension
GO:0046664 P dorsal closure, amnioserosa morphology change
GO:0046843 P dorsal appendage formation
GO:0048615 P embryonic anterior midgut (ectodermal) morphogenesis
GO:0048675 P axon extension
GO:0048747 P muscle cell development
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0048814 P regulation of dendrite morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0050807 P regulation of synapse organization
GO:0050975 P sensory perception of touch
GO:0051017 P actin filament bundle assembly
GO:0051450 P myoblast proliferation
GO:0051491 P positive regulation of filopodium assembly
GO:0051726 P regulation of cell cycle
GO:0051963 P regulation of synapse assembly
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0071907 P determination of digestive tract left/right asymmetry
GO:0090303 P positive regulation of wound healing
GO:0097206 P nephrocyte filtration
GO:1902669 P positive regulation of axon guidance
GO:1904059 P regulation of locomotor rhythm
RNA-seq EntryA_TrvaMG_comp26680_c2_seq1
Sequence
(Amino Acid)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
EDKDTIEKLKDKKLAPITYTQGLGMSKEINAVKYLECSALTQKGLKTVFDEAIRAVLCPV
QPIKRKRHCSLF
*(63 a.a.)

- SilkBase 1999-2023 -