SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG13589_complete:A_TrvaMG_comp26653_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005847 C mRNA cleavage and polyadenylation specificity factor complex
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006661 P phosphatidylinositol biosynthetic process
GO:0008654 P phospholipid biosynthetic process
GO:0010761 P fibroblast migration
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016307 F phosphatidylinositol phosphate kinase activity
GO:0016308 F 1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0016310 P phosphorylation
GO:0016607 C nuclear speck
GO:0016740 F transferase activity
GO:0019900 F kinase binding
GO:0030027 C lamellipodium
GO:0031532 P actin cytoskeleton reorganization
GO:0032587 C ruffle membrane
GO:0042995 C cell projection
GO:0046488 P phosphatidylinositol metabolic process
GO:0046854 P phosphatidylinositol phosphate biosynthetic process
GO:0048041 P focal adhesion assembly
GO:0060326 P cell chemotaxis
GO:0072661 P protein localization to plasma membrane
GO:0090630 P activation of GTPase activity
GO:0097178 P ruffle assembly
RNA-seq EntryA_TrvaMG_comp26653_c0_seq2
Sequence
(Amino Acid)
MASGDSDRIEVMESSVLKKSENAAEQSVVEDDDRDRSSIAEKNVPYDPAVGPMGAIGKVH
KSDRKIGHRRVGEGGEITYKKIQSSQIMGSIQLGIQHAIGGLASKPERDLLMQDFMTVET
TNFPHEGSNHTPAHHYSEFKFKTYAPIAFRYFRDLFGIQPDDFLMSMCSAPLRELSNPGA
SGSIFYLTNDDEFIIKTVQHKEGEFLQKLLPGYYLNLDQNPA
*(73 a.a.)

- SilkBase 1999-2023 -