SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG13356_3prime_partial:A_TrvaMG_comp26611_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0001656 P metanephros development
GO:0003007 P heart morphogenesis
GO:0003151 P outflow tract morphogenesis
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007064 P mitotic sister chromatid cohesion
GO:0007420 P brain development
GO:0007507 P heart development
GO:0007605 P sensory perception of sound
GO:0008022 F protein C-terminus binding
GO:0010468 P regulation of gene expression
GO:0019827 P stem cell population maintenance
GO:0031065 P positive regulation of histone deacetylation
GO:0032116 C SMC loading complex
GO:0034088 P maintenance of mitotic sister chromatid cohesion
GO:0034613 P cellular protein localization
GO:0035115 P embryonic forelimb morphogenesis
GO:0035136 P forelimb morphogenesis
GO:0035261 P external genitalia morphogenesis
GO:0036033 F mediator complex binding
GO:0040018 P positive regulation of multicellular organism growth
GO:0042471 P ear morphogenesis
GO:0042634 P regulation of hair cycle
GO:0042826 F histone deacetylase binding
GO:0045444 P fat cell differentiation
GO:0045778 P positive regulation of ossification
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0045995 P regulation of embryonic development
GO:0047485 F protein N-terminus binding
GO:0048557 P embryonic digestive tract morphogenesis
GO:0048589 P developmental growth
GO:0048592 P eye morphogenesis
GO:0048638 P regulation of developmental growth
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048703 P embryonic viscerocranium morphogenesis
GO:0050890 P cognition
GO:0060325 P face morphogenesis
GO:0061010 P gall bladder development
GO:0061038 P uterus morphogenesis
GO:0070062 C extracellular exosome
GO:0070087 F chromo shadow domain binding
GO:0071481 P cellular response to X-ray
RNA-seq EntryA_TrvaMG_comp26611_c0_seq1
Sequence
(Amino Acid)
MNERDIPSVPITTLAGVASLTDLLPVLPLPTPLPSTLNNKSQLFHPLVAEEAAKLLATRD
KDLVSQLLDSLMQTSVRNIDLKDESIPNAVSPAPTQQSTPELLKAILSINPN
(36 a.a.)

- SilkBase 1999-2023 -