SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG13241_complete:A_TrvaMG_comp26592_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005007 F fibroblast growth factor-activated receptor activity
GO:0005524 F ATP binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0006468 P protein phosphorylation
GO:0008201 F heparin binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0010628 P positive regulation of gene expression
GO:0010715 P regulation of extracellular matrix disassembly
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0017134 F fibroblast growth factor binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019216 P regulation of lipid metabolic process
GO:0030133 C transport vesicle
GO:0042593 P glucose homeostasis
GO:0045862 P positive regulation of proteolysis
GO:0046777 P protein autophosphorylation
GO:0048554 P positive regulation of catalytic activity
GO:0055062 P phosphate ion homeostasis
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070857 P regulation of bile acid biosynthetic process
GO:2000188 P cholesterol homeostasis
GO:2000573 P positive regulation of DNA biosynthetic process
RNA-seq EntryA_TrvaMG_comp26592_c0_seq1
Sequence
(Amino Acid)
MPGGETMTVAAKMVTEDASQEEMQDFFREIEMLKHVGYHKHVIRLVGCCTKIAPLIALLE
HAPRGDLLSLLRAARGKRKETQSSNVTRRVDSDVNGKPSEADSEYTNLSDSDPALSDGKL
NLDSYSKRLKNRDHYVAEPALHLDSTTMREYALQVALGMRHLEGRGITHRDLAARNILVD
SAGVLKVADFGLSRSGVYVHTRSRPVPLRWLAPEAILHSQYCSKSDVWAFAVLLWEIATL
GGFPYAELSNYQVPAFLAGGGRLPKPNRASARLYELMVECWSEDPQDRPTFAQIVDKLVS
QQQLYVDLECVFPPSEEDVGFRDDDYALPSPFPRDTPLMYKD
*(113 a.a.)

- SilkBase 1999-2023 -