SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG13049_complete:A_TrvaMG_comp26544_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000226 P microtubule cytoskeleton organization
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005923 C bicellular tight junction
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007616 P long-term memory
GO:0008284 P positive regulation of cell population proliferation
GO:0008286 P insulin receptor signaling pathway
GO:0015459 F potassium channel regulator activity
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016324 C apical plasma membrane
GO:0016363 C nuclear matrix
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0030010 P establishment of cell polarity
GO:0030054 C cell junction
GO:0031252 C cell leading edge
GO:0031333 P negative regulation of protein-containing complex assembly
GO:0031532 P actin cytoskeleton reorganization
GO:0031584 P activation of phospholipase D activity
GO:0031941 C filamentous actin
GO:0031982 C vesicle
GO:0032148 P activation of protein kinase B activity
GO:0032753 P positive regulation of interleukin-4 production
GO:0032869 P cellular response to insulin stimulus
GO:0034613 P cellular protein localization
GO:0035556 P intracellular signal transduction
GO:0035748 C myelin sheath abaxonal region
GO:0043066 P negative regulation of apoptotic process
GO:0043203 C axon hillock
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043274 F phospholipase binding
GO:0045121 C membrane raft
GO:0045179 C apical cortex
GO:0045630 P positive regulation of T-helper 2 cell differentiation
GO:0046326 P positive regulation of glucose import
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0046628 P positive regulation of insulin receptor signaling pathway
GO:0046872 F metal ion binding
GO:0047496 P vesicle transport along microtubule
GO:0048471 C perinuclear region of cytoplasm
GO:0050732 P negative regulation of peptidyl-tyrosine phosphorylation
GO:0050806 P positive regulation of synaptic transmission
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051222 P positive regulation of protein transport
GO:0051291 P protein heterooligomerization
GO:0051346 P negative regulation of hydrolase activity
GO:0051899 P membrane depolarization
GO:0060081 P membrane hyperpolarization
GO:0060291 P long-term synaptic potentiation
GO:0070062 C extracellular exosome
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070528 P protein kinase C signaling
GO:0071889 F 14-3-3 protein binding
GO:0072659 P protein localization to plasma membrane
GO:1990138 P neuron projection extension
GO:2000463 P positive regulation of excitatory postsynaptic potential
GO:2000553 P positive regulation of T-helper 2 cell cytokine production
GO:2000664 P positive regulation of interleukin-5 production
GO:2000667 P positive regulation of interleukin-13 production
GO:2001181 P positive regulation of interleukin-10 production
RNA-seq EntryA_TrvaMG_comp26544_c2_seq1
Sequence
(Amino Acid)
MPSSVSESEATYTRAFWTPWKSMADLAEAVDDLICSFDYMDTAMDNLVMLIFIWMVLSIA
MLAIAKWAYGKLAKKTDTKIEDTKTTTNEIVTSADTVLATSAKIKSASFKPSKTGFVPAT
PPTKKRLGRMSPGPEQLSVKKHQSIIVPTCTGSDQPSVQWVNDVLTWLYNDLVIVNELVQ
QWITSMNEFSKKSVEEQGIGVEIVRALDSHPPSISNVFCECDSKDDVTITCDCEATPAFQ
VKAFSQRGEKVEVSHYRVNVNRFRARLNVVCVTDKLTGELKFDGWPEVKIALAPVGALRP
NATESNLQQLISDIVVNALRSSQLQFNLSQYPTCPRLRRYVETSPRLPLHYDSMLQNDRH
LYTSTPNASGNGGLLGDKRLLVKVVGAKDLGGKTGCIAPYCVVEMDEPPQRNQTGFKKET
TGPQWDEHFLFDLSPQTAELLFEVYDRTGPPSPGGGSSQHRFLGLGLVGIDELLAAPSQR
QQLALQTRPMEEHDVSGTLTVEFLFIDGPDIPDFGSRPVKIKESLRTLSPHGQMTTTTKT
TFHQNGIPSPDNSKLTESALRELELSSAGGANKSTLIIHSVQREPKKSIMVELTDSGKFI
EVERDAIDKQDTIEKHLNKIEEKNTDKKSVTPNQSPGKSVRIKENGAKVNGESEQGDYVN
NQTENMSPEPAPRKRRRDFFGTIKRRLGRSRTRGQSLEMTDSEIETQNRIRSISAERNSH
DKALALPNRNVYSAGASPAQSGDESRTSRSEVSGFSTASARTFIHEASTLVLETIEAGIK
KHYLVPLAIAQRSKWRRKGVKLHIYNEHTFIAKHLSGGTVCAVCTKTVARRLGKQGYECR
DCRLRCHKHCHVRVPTTCPASTVHNMELSYIASPYADKNIRML
*(293 a.a.)

- SilkBase 1999-2023 -