SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG13016_complete:A_TrvaMG_comp26533_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0001745 P compound eye morphogenesis
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007355 P anterior region determination
GO:0007389 P pattern specification process
GO:0007399 P nervous system development
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007420 P brain development
GO:0007628 P adult walking behavior
GO:0008056 P ocellus development
GO:0010628 P positive regulation of gene expression
GO:0035284 P brain segmentation
GO:0035288 P anterior head segmentation
GO:0042051 P compound eye photoreceptor development
GO:0042052 P rhabdomere development
GO:0042463 P ocellus photoreceptor cell development
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0045315 P positive regulation of compound eye photoreceptor development
GO:0045871 P obsolete negative regulation of rhodopsin gene expression
GO:0045872 P obsolete positive regulation of rhodopsin gene expression
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046552 P photoreceptor cell fate commitment
GO:0046982 F protein heterodimerization activity
GO:0048816 P ocellus morphogenesis
GO:0061541 P rhabdomere morphogenesis
RNA-seq EntryA_TrvaMG_comp26533_c0_seq1
Sequence
(Amino Acid)
MALLTNSSTTGPAGGGPTAAQAHHSTTPLHHYFHYLKQPSPLAQNPYAHHSGAHHMGMGP
GPLGGLGPFGLTPHGLEAVGFPQGVNPRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMR
EEVALKINLPESRVQVWFKNRRAKCRQQLQQQSNSQISSKSSSTKTNVSSSNTIKSTTTS
KPTTSKTLTSSSTSLTTSQNSITTSSPNLPITPTTSVSPPINVICKKEAAGSSYETSPLT
KNSLTSLSHYDSRVSGKESSENIHGYGVTPKQELYSSPKRLDYASKLDYSEKSFGSNLVK
DQYSSRLTGNLTPLGSNSSIMTTPSPPITPQSINGPGNVYHPDNYNSFHWPGSSDYIRSY
STSHHHQGYGQSAYNSPYYPSQMEYFNGATVNQTHGGHHNLTSNSNQLYNQVSFGNPSPP
TGWSSHNILPPGSESPENQQNPHLSMLQASQITNFSNTGNSYFAPEKYGINMV
*(157 a.a.)

- SilkBase 1999-2023 -