SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG13002_complete:A_TrvaMG_comp26524_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001223 F transcription coactivator binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004693 F cyclin-dependent protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006282 P regulation of DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007346 P regulation of mitotic cell cycle
GO:0008023 C transcription elongation factor complex
GO:0008024 C cyclin/CDK positive transcription elongation factor complex
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0010613 P positive regulation of cardiac muscle hypertrophy
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0017069 F snRNA binding
GO:0031056 P regulation of histone modification
GO:0031297 P replication fork processing
GO:0033129 P positive regulation of histone phosphorylation
GO:0042493 P response to xenobiotic stimulus
GO:0042795 P snRNA transcription by RNA polymerase II
GO:0043231 C intracellular membrane-bounded organelle
GO:0044212 F transcription cis-regulatory region binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050434 P positive regulation of viral transcription
GO:0051147 P regulation of muscle cell differentiation
GO:0071157 P regulation of cell cycle
GO:0071345 P cellular response to cytokine stimulus
GO:0097322 F 7SK snRNA binding
GO:1900364 P negative regulation of mRNA polyadenylation
GO:1903839 P positive regulation of mRNA 3'-UTR binding
GO:2001168 P positive regulation of histone H2B ubiquitination
RNA-seq EntryA_TrvaMG_comp26524_c0_seq2
Sequence
(Amino Acid)
MQTVSAPREPTQPVLSTTSTILNMREKEKYIEDFDFPFCDESSKYEKVAKIGQGTFGEVF
KARARNSSKKFVAMKKVLMDNEKEGFPITALREIKILQLLKHENVVNLIEICRTKATIHN
KYRSTFYLVFDFCEHDLAGLLSNVNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAA
NVLITKNGTLKLADFGLARAFSVAKSGQANKYTNRVVTLWYRPPELLLGDRNYGPPVDMW
GAGCIMAEMWTRSPIMQVCHQLQIQKSCISTRP
*(90 a.a.)

- SilkBase 1999-2023 -