SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG12_internal:A_TrvaMG_comp2269_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		beta_adrenergic-like_octopamine_receptor_1,_partial_[Trichoplusia_ni]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0004935 F adrenergic receptor activity
GO:0004989 F octopamine receptor activity
GO:0004993 F G protein-coupled serotonin receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007188 P adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007210 P serotonin receptor signaling pathway
GO:0008227 F G protein-coupled amine receptor activity
GO:0010579 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0051482 P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway
GO:0071875 P adrenergic receptor signaling pathway
RNA-seq EntryA_TrvaMG_comp2269_c0_seq1
Sequence
(Amino Acid)
FPNVCSFTVNKVYAVISSSVSFWIPGVIMLFMYYRIYVEADRQERMLYRSKVAALLLDKH
LQINGISMGDVMRERTSIQMQPMASSKMKRERKAARTLGIIMSA
(33 a.a.)

- SilkBase 1999-2023 -