SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG12918_3prime_partial:A_TrvaMG_comp26505_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006909 P phagocytosis
GO:0006911 P phagocytosis, engulfment
GO:0006915 P apoptotic process
GO:0006928 P movement of cell or subcellular component
GO:0016020 C membrane
GO:0016477 P cell migration
GO:0016601 P Rac protein signal transduction
GO:0017124 F SH3 domain binding
GO:0030029 P actin filament-based process
GO:0030036 P actin cytoskeleton organization
GO:0032045 C guanyl-nucleotide exchange factor complex
GO:0038096 P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0043547 P positive regulation of GTPase activity
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0050690 P regulation of defense response to virus by virus
RNA-seq EntryA_TrvaMG_comp26505_c0_seq1
Sequence
(Amino Acid)
MIINDIESGKFKGKPLKYALITFVELMDHNVIFWDILENQFINKIASFVSNQANPQEPKI
IQCCLSILENIVLNSSKNSQVEKEITIPSLISHLNSQQDSIIQQNAIALINAIFSKTDMT
KKKTIAATLSSKQVRNVIY
(45 a.a.)

- SilkBase 1999-2023 -