SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG12787_complete:A_TrvaMG_comp26469_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001752 P compound eye photoreceptor fate commitment
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006355 P regulation of transcription, DNA-templated
GO:0006914 P autophagy
GO:0007275 P multicellular organism development
GO:0007458 P progression of morphogenetic furrow involved in compound eye morphogenesis
GO:0007552 P metamorphosis
GO:0007562 P eclosion
GO:0008219 P cell death
GO:0009608 P response to symbiont
GO:0010629 P negative regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0030707 P ovarian follicle cell development
GO:0035070 P salivary gland histolysis
GO:0035071 P salivary gland cell autophagic cell death
GO:0035072 P ecdysone-mediated induction of salivary gland cell autophagic cell death
GO:0035075 P response to ecdysone
GO:0035193 P larval central nervous system remodeling
GO:0040034 P regulation of development, heterochronic
GO:0042332 P gravitaxis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
GO:0048747 P muscle cell development
GO:0048808 P male genitalia morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0071390 P cellular response to ecdysone
RNA-seq EntryA_TrvaMG_comp26469_c0_seq2
Sequence
(Amino Acid)
MRYVKRISQVCRFASAMQSACHSVSGADWFPAVPGVARPRPLTNALMLVVMCGAVGPLGA
GHRCEVCGKLLSTRLTLKRHTEQQHLQPLHSARCTLCHKVFRTLNSLNNHKSIYHRRQRN
PPPLSQPHSLAQSLAQPQNLSAGVEPKLNPPHHNIDFYKFKDQFNV
*(54 a.a.)

- SilkBase 1999-2023 -