SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG12744_3prime_partial:A_TrvaMG_comp26451_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000014 F single-stranded DNA endodeoxyribonuclease activity
GO:0000166 F nucleotide binding
GO:0000722 P telomere maintenance via recombination
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0000790 C chromatin
GO:0000793 C condensed chromosome
GO:0000794 C condensed nuclear chromosome
GO:0002168 P instar larval development
GO:0003690 F double-stranded DNA binding
GO:0003691 F double-stranded telomeric DNA binding
GO:0004003 F DNA helicase activity
GO:0004017 F adenylate kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007004 P telomere maintenance via telomerase
GO:0007049 P cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0008104 P protein localization
GO:0008408 F 3'-5' exonuclease activity
GO:0016233 P telomere capping
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0030870 C Mre11 complex
GO:0032508 P DNA duplex unwinding
GO:0035861 C site of double-strand break
GO:0043047 F single-stranded telomeric DNA binding
GO:0046872 F metal ion binding
GO:0046939 P nucleotide phosphorylation
GO:0051276 P chromosome organization
GO:0051321 P meiotic cell cycle
GO:0051880 F G-quadruplex DNA binding
GO:0070192 P chromosome organization involved in meiotic cell cycle
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_TrvaMG_comp26451_c1_seq1
Sequence
(Amino Acid)
MAGVRSLAIRGIRSFGPEDTDEQRILFDSPLTLILGQNGCGKTTVIECLRYAITGQMPPG
SRNECFVHDAKVNRSTEVLGQVKLKIVNAKDKQLEVTRSMKVTALAKKKTKFQTLDSFLS
TVDDTGKTKDISSRCADLDFLMHEELGVSKAILNSVIFCHQEDSSWPLDEGKKVKERFDE
IFDADKYSDCLDRLKKIRKDYVQNLKLLEQEVSFLTEKKQDLDKKKLNVVNTEMEISKTE
TKVTELTQELKPVSEKLTAIKTLENNLLSYETKREKIKMRLEQARTNEEKLKTNIKTVFE
GTQEELEENIKNYAATVKAKQKELDDSYKKNKSFNKEEENIANE
(113 a.a.)

- SilkBase 1999-2023 -