SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG12602_3prime_partial:A_TrvaMG_comp26420_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000147 P actin cortical patch assembly
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0006897 P endocytosis
GO:0007015 P actin filament organization
GO:0008360 P regulation of cell shape
GO:0030036 P actin cytoskeleton organization
GO:0030048 P actin filament-based movement
GO:0030479 C actin cortical patch
GO:0031097 C medial cortex
GO:0035840 C old growing cell tip
GO:0045010 P actin nucleation
GO:0051015 F actin filament binding
GO:0051127 P positive regulation of actin nucleation
GO:0051666 P actin cortical patch localization
RNA-seq EntryA_TrvaMG_comp26420_c0_seq1
Sequence
(Amino Acid)
MGPKPPPPPGPPPPPGPPPPPVFGGAPKKGGGADDRNALLSSIRQGAKLKKTVTVDKSGP
YIPGKVSNSASSGPPAGNGVRSAPPMQNGGAPPGLGGLFAGGMPKLR
(34 a.a.)

- SilkBase 1999-2023 -