SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG12537_complete:A_TrvaMG_comp26407_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0002268 P follicular dendritic cell differentiation
GO:0002315 P marginal zone B cell differentiation
GO:0002455 P humoral immune response mediated by circulating immunoglobulin
GO:0002467 P germinal center formation
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0008134 F transcription factor binding
GO:0009615 P response to virus
GO:0010225 P response to UV-C
GO:0019730 P antimicrobial humoral response
GO:0030198 P extracellular matrix organization
GO:0030330 P DNA damage response, signal transduction by p53 class mediator
GO:0032729 P positive regulation of interferon-gamma production
GO:0032996 C Bcl3-Bcl10 complex
GO:0033257 C Bcl3/NF-kappaB2 complex
GO:0042088 P T-helper 1 type immune response
GO:0042345 P regulation of NIK/NF-kappaB signaling
GO:0042536 P negative regulation of tumor necrosis factor production
GO:0042742 P defense response to bacterium
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042832 P defense response to protozoan
GO:0042981 P regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0045064 P T-helper 2 cell differentiation
GO:0045082 P positive regulation of interleukin-10 production
GO:0045171 C intercellular bridge
GO:0045415 P negative regulation of interleukin-8 production
GO:0045727 P positive regulation of translation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048471 C perinuclear region of cytoplasm
GO:0048536 P spleen development
GO:0051101 P regulation of DNA binding
RNA-seq EntryA_TrvaMG_comp26407_c0_seq2
Sequence
(Amino Acid)
MESRAKTMRPIIIRKSGQNKIQLTNQTLFKSDLIYESKDGDFLHKASQKTTIINTLNRAT
NVSRTIVTYSDENGVKTGNSDAIVQLIGQDKYDILFSALCSVISQELKVRGILALLTTPK
KTEKTANVSTQTALPLLIENSSQTKESHINMFAKPKIKRIRRRTITPYVVKESKVNKVVI
NPEDYVKKATNEFSSNESWLSIKTTSSLLYDPLSIVEKPKVDVSSVTVKSENLSVSDEEK
NKMEFYQSYLDWTKCLEEDEDGNLPIHTAVLDNDIKCLWRQCQVLQRKKQSVDIPGNSDW
TALKLAILKDHLQCTEILLKFHPNLLLADENNKICLHHAAEIQSKHLNLILDYCKINARK
IISEDEDLWKENFTEYSDEDLLHYLMNFMCNHCDNEGNTPLNIASKRGNYENVRLLLQVE
PSTVNFRMPTNGDTALHSAVVSAITEIRETSNKTTVENYKKTIEQLIINDACPSINNTSG
VSVNDILTESNVPALSLSIANAMASKRLTGTAKFDSYMLLKNKNGDINVTEIKKNKNKTV
ILENVLVTDVRSLTNKVKSDCLSVCKGVNVKNIKITAKRKSDEQVKIIKKVKV
*(197 a.a.)

- SilkBase 1999-2023 -