SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG12488_3prime_partial:A_TrvaMG_comp26395_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003053 P circadian regulation of heart rate
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006606 P protein import into nucleus
GO:0007617 P mating behavior
GO:0007620 P copulation
GO:0007622 P rhythmic behavior
GO:0007623 P circadian rhythm
GO:0008062 P eclosion rhythm
GO:0008134 F transcription factor binding
GO:0009648 P photoperiodism
GO:0009649 P entrainment of circadian clock
GO:0030431 P sleep
GO:0042306 P regulation of protein import into nucleus
GO:0042749 P regulation of circadian sleep/wake cycle
GO:0043234 C protein-containing complex
GO:0045187 P regulation of circadian sleep/wake cycle, sleep
GO:0045475 P locomotor rhythm
GO:0046957 P negative phototaxis
GO:0046982 F protein heterodimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0048511 P rhythmic process
GO:0048512 P circadian behavior
GO:0050764 P regulation of phagocytosis
GO:0050766 P positive regulation of phagocytosis
GO:0060086 P circadian temperature homeostasis
GO:0071482 P cellular response to light stimulus
GO:2000678 P negative regulation of transcription regulatory region DNA binding
RNA-seq EntryA_TrvaMG_comp26395_c0_seq1
Sequence
(Amino Acid)
MEWVLRSPQIHSTFGNLGFHLADGYHVNENCNNALESILHNILSEDKYLRTYRRSISFGQ
NVKKDLIPLLIHAKDDKTIEILIRILVNLTIPIECLLSVDVISKNDFGRHTIFEINNLLA
TTKIAFTDQRATKVIIEFLKKNVDFEQKSKLTVEQCTNISNSLLLLRNILHIPEETANQN
PSFNSPIHTIQNQIIWNIFSQGIDKALIKLMTIPDAVSSEDMLYCNNNILDNIFNSRIE
(78 a.a.)

- SilkBase 1999-2023 -