SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG12390_3prime_partial:A_TrvaMG_comp26378_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001933 P negative regulation of protein phosphorylation
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005829 C cytosol
GO:0005938 C cell cortex
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006897 P endocytosis
GO:0007269 P neurotransmitter secretion
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0008021 C synaptic vesicle
GO:0008293 P torso signaling pathway
GO:0008333 P endosome to lysosome transport
GO:0008593 P regulation of Notch signaling pathway
GO:0016050 P vesicle organization
GO:0016079 P synaptic vesicle exocytosis
GO:0016082 P synaptic vesicle priming
GO:0016197 P endosomal transport
GO:0016322 P neuron remodeling
GO:0031398 P positive regulation of protein ubiquitination
GO:0032509 P endosome transport via multivesicular body sorting pathway
GO:0033565 C ESCRT-0 complex
GO:0033619 P membrane protein proteolysis
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0043130 F ubiquitin binding
GO:0045743 P positive regulation of fibroblast growth factor receptor signaling pathway
GO:0045752 P positive regulation of Toll signaling pathway
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051726 P regulation of cell cycle
GO:1990182 P exosomal secretion
GO:2000274 P regulation of epithelial cell migration, open tracheal system
RNA-seq EntryA_TrvaMG_comp26378_c0_seq4
Sequence
(Amino Acid)
MFRANNFDKLLDKATSNLRLDPDWPTILQICDLIRQNDCTPKYAVAAVKKKLYSQNPHQA
MFALLTLESIVKNCGSGIHDEVTSKAFCEMLRDLVKTTQHENLRTKILELIQAWAFAFRN
SPKYRAVQDTVNILKAEGYKFPALKESDAMFSADTAPEWADGEVCHRCRIAFSLMVR
(58 a.a.)

- SilkBase 1999-2023 -