SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG12177_complete:A_TrvaMG_comp26321_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0000280 P nuclear division
GO:0000287 F magnesium ion binding
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005875 C microtubule associated complex
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0045448 P mitotic cell cycle, embryonic
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0046872 F metal ion binding
GO:0051225 P spindle assembly
GO:0051299 P centrosome separation
GO:0051301 P cell division
GO:0051642 P centrosome localization
RNA-seq EntryA_TrvaMG_comp26321_c0_seq3
Sequence
(Amino Acid)
MDVKPGNIFICSSDSDVARDSDDGYDDDEQRDTHKYKIGDLGHVTCISSPAVEEGDCRYL
PKEVLHEDFSQLPKADIFAFGLTLFEAAGGGPLPKNGVKWHEYRDGKLPDLPNLSREFND
LLKSMVHPEPARRPSARRLRRVSWSAPHKTRAQLRRELAAANMKNELLARKLHDAAKCIK
SLTPGLESTKFRTRSAAKKTLKQRDSRLSELLQL
*(70 a.a.)

- SilkBase 1999-2023 -