SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG12101_internal:A_TrvaMG_comp26295_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000922 C spindle pole
GO:0004721 F phosphoprotein phosphatase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006366 P transcription by RNA polymerase II
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0006470 P protein dephosphorylation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008420 F RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0010458 P exit from mitosis
GO:0015629 C actin cytoskeleton
GO:0016591 C RNA polymerase II, holoenzyme
GO:0016787 F hydrolase activity
GO:0030496 C midbody
GO:0050434 P positive regulation of viral transcription
GO:0051233 C spindle midzone
GO:0051301 P cell division
GO:0061052 P negative regulation of cell growth involved in cardiac muscle cell development
GO:0070940 P dephosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_TrvaMG_comp26295_c0_seq2
Sequence
(Amino Acid)
FPFKMADKTIPIFVPFEKPVKLAKWKIKQGTVVTQGQVLFLYKDLSSDSEELKKFKTTRG
GIVSSIKVKEGDVVEPSSAVADLKECQHPTVMMEMCAECGSDLRSEETKKLDVAVVPMVS
EEL
(40 a.a.)

- SilkBase 1999-2023 -