| Name | O_TrvaMG12098_complete:A_TrvaMG_comp26294_c0_seq2 |
| Scaffold_id | |
NCBI non-redundant (nr) | |
| Ontology |
| GO:0000902 |
P |
cell morphogenesis |
| GO:0003323 |
P |
type B pancreatic cell development |
| GO:0005764 |
C |
lysosome |
| GO:0005765 |
C |
lysosomal membrane |
| GO:0009749 |
P |
response to glucose |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0033227 |
P |
dsRNA transport |
| GO:0042593 |
P |
glucose homeostasis |
| GO:0044342 |
P |
type B pancreatic cell proliferation |
| GO:0051033 |
F |
RNA transmembrane transporter activity |
| GO:0061178 |
P |
regulation of insulin secretion involved in cellular response to glucose stimulus |
|
| RNA-seq Entry | A_TrvaMG_comp26294_c0_seq2 |
Sequence (Amino Acid) | MGNAILYTLFYLIMKLVHRERIKLRTWMYCLLAHVAWFTALHLFLDSKTKWSETPAQSRQ
HNAPCSSLSFYDTHDLWHALSAVAMYISFNMLLTMDDALIDTPRDQIPTF
*(36 a.a.) |