SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG11_internal:A_TrvaMG_comp1729_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protein_timeless_homolog_isoform_X4_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0002009 P morphogenesis of an epithelium
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006260 P DNA replication
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007275 P multicellular organism development
GO:0007623 P circadian rhythm
GO:0009582 P detection of abiotic stimulus
GO:0009628 P response to abiotic stimulus
GO:0015630 C microtubule cytoskeleton
GO:0030324 P lung development
GO:0042127 P regulation of cell population proliferation
GO:0042752 P regulation of circadian rhythm
GO:0042803 F protein homodimerization activity
GO:0044770 P cell cycle phase transition
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046982 F protein heterodimerization activity
GO:0048511 P rhythmic process
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0051301 P cell division
RNA-seq EntryA_TrvaMG_comp1729_c0_seq1
Sequence
(Amino Acid)
FHYVQQQMEKYYDMIKLEKKKYSVWVRRLHLALRAYKELLHTLLEMEKSTDPTVKESAKV
LKSNIFYVLEYREFVLNTFLNYDENKMPRSYLVDLLETVHLFLKMLEHYCKKTGLVVQKK
VKKKSKSKKSVVRRAAVSAVSAVAVHV
(48 a.a.)

- SilkBase 1999-2023 -